PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002494-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 379aa    MW: 41145.2 Da    PI: 6.2535
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002494-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.9e-133275144
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +g W++eEd++l+++    G g+W+ +ar  g+ R++k+c++rw
  AHYPO_002494-RA 32 KGLWSPEEDDKLINYMLTNGQGCWSDVARNAGLQRCGKSCRLRW 75
                     678***************************************** PP

2Myb_DNA-binding23.51.3e-0774962346
                     -HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding 23 tWktIartmgkgRtlkqcksrwqk 46
                     +W+ Ia++++ gRt++++k++w++
  AHYPO_002494-RA 74 RWSQIAARLP-GRTDNEIKNFWNS 96
                     4*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0812783IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-163075IPR009057Homeodomain-like
SMARTSM007173.4E-1131100IPR001005SANT/Myb domain
PfamPF002495.4E-123275IPR001005SANT/Myb domain
SuperFamilySSF466895.01E-163299IPR009057Homeodomain-like
CDDcd001676.81E-93598No hitNo description
Gene3DG3DSA:1.10.10.607.6E-1176103IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MRKPADPTAK TNGNGGGSGG GSGNNGGAKL RKGLWSPEED DKLINYMLTN GQGCWSDVAR  60
NAGLQRCGKS CRLRWSQIAA RLPGRTDNEI KNFWNSTVKK RLKNSSNSSS PNASDSSLST  120
EPRDHGMMTG FMAMQDPSCI MAMYVNNNTT SSPTSSSMQS MVHPLTHHHH HHIGIMDPCM  180
SNMVNHITST NTNTTNGLDM PSSYGNNGFM DATSCMSMTT LNGMANVDND HGLMCGSYGM  240
LGGHSYNYGL LHGELSIPSL ETISIEENNT HISQNIVFDK NTSHNNTNHF NNTNTNNQFD  300
HNNTHITNTP LNNSITSSKK FEAVVCGVGN TWKDAGGEQP RVAGEWQDAG GEMTGEWDDL  360
EELMNSVSSF PFTDYQVE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673636.11e-119PREDICTED: transcription factor MYB86-like
TrEMBLA0A0J8CL661e-119A0A0J8CL66_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-38myb domain protein 46